PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.251210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family bHLH
Protein Properties Length: 123aa    MW: 14530 Da    PI: 9.8948
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.251210.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH41.91.8e-13153155
                    CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
             HLH  1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                    ++ +h   Er RR+++ s + +Lr+llP  +   +++ s ++i+ +Av+YI +L+
  Cucsa.251210.1  1 KKIMHRDLERERRKQMASLLTNLRSLLPLEF--IKGRRSRVDIVDEAVNYIEYLR 53
                    5789*************************65..********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000101.1E-10152IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.07E-9153No hitNo description
SuperFamilySSF474598.77E-14169IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.922152IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.1E-11267IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.2E-6658IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
KKIMHRDLER ERRKQMASLL TNLRSLLPLE FIKGRRSRVD IVDEAVNYIE YLRGRMNELH  60
VKRDAIQYSG GLEIVISNGI ISEQNFQLSG VMRVLIEQRC CTLFRQRLFD YLLLQDLNLF  120
FI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818482e-45LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132602e-45LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148147.12e-57PREDICTED: transcription factor bHLH36-like
SwissprotQ9FLI15e-24BH036_ARATH; Transcription factor bHLH36
TrEMBLA0A0A0L9L02e-57A0A0A0L9L0_CUCSA; Uncharacterized protein
STRINGAT5G51780.11e-21(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51780.12e-17bHLH family protein